PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.1637s0009.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family GATA
Protein Properties Length: 298aa    MW: 33050.4 Da    PI: 8.2302
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.1637s0009.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA63.62.2e-20216250135
                 GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                          C++C ttkTp+WR+gp+g+ktLCnaCG++yr+ +l
  Cagra.1637s0009.1.p 216 CTHCETTKTPQWREGPSGPKTLCNACGVRYRSGRL 250
                          *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.0E-20210260IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.24E-15214273No hitNo description
PROSITE profilePS5011412.281214246IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.3E-15214247IPR013088Zinc finger, NHR/GATA-type
CDDcd002024.50E-17215264No hitNo description
PfamPF003204.2E-18216250IPR000679Zinc finger, GATA-type
PROSITE patternPS003440216241IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNWLPEEDFK GILSDDFFDD LVDQLDCPLE DTNGEGDWVA KFQDLEPPPM DMFPTLPCHL  60
TSCANAKPAP LGFHKTVPPL KHSSSSEALS GINSTLHQSS PPPDIKVSKM FQSLSPVSVF  120
VSSCDSLSPQ NSRSQGLAFP VKGMRSKRKR PTTLRFSYLL PFEPRMPEKL TPGESGSESY  180
HSSEQHAKKK RKIQLTTHTV SSSFEASNSD GIVRKCTHCE TTKTPQWREG PSGPKTLCNA  240
CGVRYRSGRL VPEYRPASSP TFIPSLHSNS HRKIIEMRRK DDNQFDTSMM HVVISGA*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00130DAPTransfer from AT1G08010Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006304051.10.0hypothetical protein CARUB_v10009871mg
RefseqXP_006304052.10.0hypothetical protein CARUB_v10009871mg
SwissprotQ6DBP81e-161GAT11_ARATH; GATA transcription factor 11
TrEMBLR0IF880.0R0IF88_9BRAS; Uncharacterized protein
STRINGAT1G08010.11e-159(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16812589
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08010.21e-147GATA transcription factor 11